1 to 25 of 26 Adobe Experience Manager Jobs in the UK

totaled $13.8 billion. Mode: Hybrid (2 days working from office) Job Summary: We are seeking a highly skilled and strategic Marketing Technology & Adobe Experience Manager (AEM) Specialist to join our digital marketing team. This role will be responsible for managing and optimizing our MarTech stack, with a strong focus on Adobe Experience Cloud … seamless digital experiences, campaign execution, and data-driven decision-making. Experience in the insurance industry domain is highly preferred. Key Responsibilities: Adobe Experience Manager (AEM): - Manage and maintain AEM Sites and Assets, including templates, components, workflows, and DAM. - Collaborate with developers and designers to implement and optimize AEM-based web experiences. - Ensure content governance, version … control, and publishing workflows are followed. - Train content authors and marketers on AEM best practices. Marketing Technology (MarTech): - Own and optimize the MarTech stack including tools like Adobe Analytics, Adobe Target, Marketo, Salesforce Marketing Cloud, Google Tag Manager, and others. - Integrate marketing platforms with CRM, CMS, and data platforms to enable seamless data flow and More ❯

totaled $13.8 billion. Mode: Hybrid (2 days working from office) Job Summary: We are seeking a highly skilled and strategic Marketing Technology & Adobe Experience Manager (AEM) Specialist to join our digital marketing team. This role will be responsible for managing and optimizing our MarTech stack, with a strong focus on Adobe Experience Cloud … seamless digital experiences, campaign execution, and data-driven decision-making. Experience in the insurance industry domain is highly preferred. Key Responsibilities: Adobe Experience Manager (AEM): - Manage and maintain AEM Sites and Assets, including templates, components, workflows, and DAM. - Collaborate with developers and designers to implement and optimize AEM-based web experiences. - Ensure content governance, version … control, and publishing workflows are followed. - Train content authors and marketers on AEM best practices. Marketing Technology (MarTech): - Own and optimize the MarTech stack including tools like Adobe Analytics, Adobe Target, Marketo, Salesforce Marketing Cloud, Google Tag Manager, and others. - Integrate marketing platforms with CRM, CMS, and data platforms to enable seamless data flow and More ❯

Generation Centre of Excellence, reporting to the Director of Marketing Data Enablement & Automation. This role collaborates closely with the broader Enterprise and Divisional marketing teams across Martech and Digital Experience and plays a critical bridge function between strategy and … technical execution. While technically adept, this role sits within the Marketing team and represents the business's strategic interests. Through Adobe Experience Cloud tools-including RTCDP, AEM, and Target-our team operationalizes enterprise-wide personalization, driving real-time, audience-centric digital engagement at scale across global web properties. Responsibilities and Impact: Develop a comprehensive strategy for web … degree in any field; Adobe Target Architect Certification strongly preferred 7+ years in technical product management roles, including 2+ years leading Adobe Target implementations Deep experience with Adobe Target architecture, configuration, and campaign execution Hands-on knowledge of Adobe Analytics and/or Google Analytics Familiarity with JavaScript, HTML, CSS, jQuery More ❯

Looking for a Digital Content Publisher to start early August, with experience in CMS & SEO best practices. Contract - Inside IR35 Rate - £140 per day (via umbrella) Location- Rickmansworth (1 day a week onsite on Wednesdays and the remaining 4 days a week remotely) Duration - until Dec end initially Job Description We're looking for a bright, enthusiastic and hard … Proactive approach to spotting business opportunities and website development opportunities Maintenance of day-to-day website inbox and requests in collaboration with the other team members Requirements Essential: Previous experience with web publishing and knowing your way around a CMS (Adobe Experience Manager & Umbraco preferred, however, training will be provided) Adaptable, ability to multi-task More ❯

our time, at our Bristol office. About this opportunity An important technical role implementing industry standards for modern web sites based on Adobe Experience Manager (AEM) Content Management System and associated Adobe technologies. Working in a cross-disciplinary team we're looking for individuals who can turn requirements into reality working as co-lead … with the Team PO for overall delivery. We're building a next generation Digital Experience Platform for the Bank that will enable a deeper richer connection to our customers. We pride ourselves on our friendly collaborative environment where opportunity, diversity and inclusivity are key, where everybody is heard. Design and build solutions that will delight and surprise both colleagues … the future, investing in our technologies, workplaces, and colleagues to make our Group a great place for everyone. Including you! What you'll need Demonstrate use of design patterns, experience and industry standards to design, test and amend complex programs/scripts and integration software services. Leading reviews of colleagues' work. JavaScript (ES6, React, Typescript), html5 and CSS (SCSS More ❯

Looking for a Digital Content Publisher for our client with experience in CMS. Hybrid - 1 day a week onsite (Wednesdays), 4 days WFH Contract role - Inside IR35 (via umbrella) Rate - Up to £140 per day Duration - 5 months initially Job Description We're looking for a bright, enthusiastic and hard-working Digital Content Publisher. The role requires a candidate … Proactive approach to spotting business opportunities and website development opportunities Maintenance of day-to-day website inbox and requests in collaboration with the other team members Requirements Essential: Previous experience with web publishing and knowing your way around a CMS (Adobe Experience Manager & Umbraco preferred, however, training will be provided) Adaptable, ability to multi-task More ❯

consistency, discoverability, and user-centric navigation. Working closely with content owners, SEO leads, UX designers, and technical teams, the Web Taxonomist will enable a more effective and scalable web experience for customers. The Impact This role is instrumental in bringing order and clarity to a complex and expansive content ecosystem. By creating and maintaining robust taxonomies and metadata structures … and technical teams to ensure taxonomy supports business goals, user experience, and search optimization. Support the development of tagging frameworks for Adobe Experience Manager (AEM), Adobe Target, and personalization tools. Serve as a subject matter expert in organizing content by audience, topic, industry, and solution areas. Collaborate with global divisional teams to align … a related field 5- 7+ years of experience in taxonomy design, metadata strategy, or content architecture in a large digital environment Familiarity with enterprise content management systems (preferably AEM), tagging tools, and digital asset management systems Understanding of SEO, UX design principles, and accessibility standards Strong communication and stakeholder engagement skills in a global organization. Additional Preferred Qualifications: Experience More ❯

Director of Sales, Adobe - Europe Location: London, England (Remote Optional) Territory: Europe - Adobe Experience Cloud Services Company Overview Blue Acorn iCi, an Infosys company, is a leading digital consultancy specializing in customer experience, commerce, and data solutions. With a team of over 400 experts, we help global enterprises drive digital transformation at scale. From … the world's most recognized brands. Position Overview Blue Acorn iCi is seeking a results-driven Director of Sales to lead pipeline generation and close strategic Adobe Experience Cloud service deals across the European market. This individual must have deep experience in Adobe services sales, a strong command of solution-based selling, and the … preferred) 5+ years experience selling digital solutions in an agency, consultancy, or Adobe partner environment Proven success in selling Adobe Experience Cloud services (AEM, Adobe Analytics, Campaign, etc.) Strong understanding of eCommerce, CMS, DAM, CDP, and marketing automation ecosystems Experience leading complex deal cycles and managing a pipeline across stages Excellent More ❯

We urgently require a Front-End Java Developer with at least 3 to 5 years experience of developing global digital marketing platform to provide a complete web experience management solution for Customer to market products & services to learners on a global scale. The candidate will be a high-performing, hands-on Front end development specialising in CSS, HTML … and ensuring the highest development standards are followed. Identification and management of technical debt. BAU code fixes and enhancements to existing sites on the platform Must have the following experience: Significant experience with building, launching and managing simple and complex websites on the Adobe Experience Manager platform Expert knowledge of web-based technologies: HTTP More ❯

Front End Java and HTML Developer ?" Brighton Sussex Our Client is looking to recruit a Front End Software Developer with very strong experience in Java Script. Must have experience with Agile development environment. Any experience with Angular JS framework knowledge would be very handy. Required knowledge and experience: Significant experience with building, launching and managing … simple and complex websites on the Adobe Experience Manager platform Expert knowledge of web-based technologies: HTTP/HTTPS, HTML, JavaScript, CSS, Less, JQuery, Angular A passion for technology and up-to-date with trends, new languages and design approaches in the IT space. Experienced in designing scalable solutions, write efficient code, optimizing performance and debugging … ability to present complex technical information in a clear and concise manner to a variety of audiences, both technical and non-technical. Formal education or equivalent: Degree or equivalent experience in Computer Science or IT related field Higher degree desirable This is a 6 month contract assignment in Brighton Sussex. Please send your to us in Word format urgently. More ❯

matter experts and EA peers to develop technology architecture that enables new business capabilities and operating models. Knowledge and Skills: Strong project delivery background with approximately 7 years of experience in system design, systems integration, or software development as a senior developer/architect. Deep knowledge of the entire software development and product lifecycle, including DevOps principles, patterns, UML … and agile practices. Technical expertise in web-based systems architecture, service-based architecture, enterprise application architecture, and cloud architecture, with experience managing expectations balancing business and financial constraints. Working knowledge of database technologies such as MS SQL and Oracle. Experience leading and developing an Informatica-based ETL architecture. End-to-end design experience, including integration with services … like Appian, Azure APIM, and Adobe Experience Manager. A proven track record of successful implementations delivering measurable business outcomes. Ability to evaluate and design data collection, staging, movement, analytics delivery, and data quality processes. If you are excited about this role but your experience does not align perfectly with every requirement, we encourage you to apply More ❯

Front End Javascript Developer with Agile - Brighton Sussex Our Client is looking to recruit a Front End Software Developer with very strong experience in Javascript in an Agile environment. Must have experience with Agile development environment. Any experience with Angular JS framework knowledge would be very handy. Required knowledge and experience: • Significant experience with building … launching and managing simple and complex websites on the Adobe Experience Manager platform • Expert knowledge of web-based technologies: HTTP/HTTPS, HTML, JavaScript, CSS, Less, JQuery, Angular • A passion for technology and up-to-date with trends, new languages and design approaches in the IT space. • Experienced in designing scalable solutions, write efficient code, optimizing … ability to present complex technical information in a clear and concise manner to a variety of audiences, both technical and non-technical. Formal education or equivalent: • Degree or equivalent experience in Computer Science or IT related field • Higher degree desirable So key skills are Javascript in an Agile environment. This is a 6 month contract assignment in Brighton Sussex. More ❯

products are displayed consistently across online touchpoints, through online merchandising acting as super user in e-commerce activation tools (Adobe Commerce, HCL Commerce and Adobe Experience Manager) gathering and defining requirements for new product and campaign launches, reporting on outcomes and overall performance The Candidate: Ideally of graduate standard, preferably from within a commercial … marketing, or digital based discipline, for the role of E-Commerce Executive, candidates will also be able to demonstrate that they have/are: previous work experience in a same or similar role, working with commerce channels and understanding how to manage and track sales performance experience with website and e-commerce CMS tools (Adobe Commerce … Magento) preferable) experience of managing product data and content on websites a strong understanding of D2C marketing and content, with experience of working with cross functional teams to activate e-commerce sales channels previous experience of launching projects and products on e-commerce websites excellent analytical and problem-solving skills, with the ability to translate data and More ❯

Front End Javascript Developer with Agile ?" Brighton Sussex Our Client is looking to recruit a Front End Software Developer with very strong experience in Javascript in an Agile environment. Must have experience with Agile development environment. Any experience with Angular JS framework knowledge would be very handy. Required knowledge and experience: Significant experience with building … launching and managing simple and complex websites on the Adobe Experience Manager platform Expert knowledge of web-based technologies: HTTP/HTTPS, HTML, JavaScript, CSS, Less, JQuery, Angular A passion for technology and up-to-date with trends, new languages and design approaches in the IT space. Experienced in designing scalable solutions, write efficient code, optimizing … ability to present complex technical information in a clear and concise manner to a variety of audiences, both technical and non-technical. Formal education or equivalent: Degree or equivalent experience in Computer Science or IT related field Higher degree desirable So key skills are Javascript in an Agile environment. This is a 6 month contract assignment in Brighton Sussex. More ❯

products are displayed consistently across online touchpoints, through online merchandising acting as super user in e-commerce activation tools (Adobe Commerce, HCL Commerce and Adobe Experience Manager) gathering and defining requirements for new product and campaign launches, reporting on outcomes and overall performance The Candidate: Ideally of graduate standard, preferably from within a commercial … marketing, or digital based discipline, for the role of E-Commerce Executive, candidates will also be able to demonstrate that they have/are: previous work experience in a same or similar role, working with commerce channels and understanding how to manage and track sales performance experience with website and e-commerce CMS tools (Adobe Commerce … Magento) preferable) experience of managing product data and content on websites a strong understanding of D2C marketing and content, with experience of working with cross functional teams to activate e-commerce sales channels previous experience of launching projects and products on e-commerce websites excellent analytical and problem-solving skills, with the ability to translate data and More ❯

accurate and consistent Agentic AI workflows that automate the entire translation process from content ingestion to quality review to publishing 100+ native integrations with systems like Adobe Experience Manager, Webflow, Salesforce, GitHub, and Google Drive to simplify content translation Human-in-the-loop reviews via our global network of professional linguists, for high-impact content that … to focus from home when needed. Authorization to work in the UK is required for this position. What You'll Do We're looking for a Senior Field Marketing Manager to lead our field and event marketing strategy across Europe. This is a high-impact role focused on driving pipeline, building brand presence, and deepening relationships with our target … visible impact on pipeline and brand presence, and grow into a people leadership role as the program scales. What You Bring: 5+ years of B2B field or event marketing experience, ideally in enterprise SaaS Proven success running both large-scale industry events and intimate, high-touch executive experiences Strong project management and budgeting skills - able to deliver multiple programs More ❯

Strong technology strategy, enterprise architecture, and solution architect background – Strong communication skills to participate in product innovation meetings at board level to discuss the technology roadmap. – A strong people manager and leader. – A very positive mindset with a can-do attitude is … key! – Passionate about getting things done and able to engage people across the business to complete goals and quickly drive value. – Any experience in Salesforce, Adobe AEM, Analytics, Targett and Campaign, Zuora and AWS will be highly beneficial – Experience working in a consultancy or digital agency environment – Strong technical understanding of software development – ideally a background More ❯

Firefly (FF) Solution Consultant ( FF SC) to solve critical client problems leveraging Adobe's cutting edge creative GenAI . Collaborating with technical experts on DMe & D igital Experience (DX) you will develop innovative solutions for to our customers' most complex problems . This role involves working across various groups, such as Product Marketing, Product Management, Engineering, and … technical solutions to showcase the value of Adobe Creative Cloud GenAI technologies in customers' workstreams . Strong knowledge of Adobe solutions, both Creative and Digital Experience , is critical. Job Responsibilities Use in-depth product knowledge to provide technical expertise to sales staff and customers through Discovery, Presentations, and Solution Demonstrations. Assist the sales staff in … trends is a plus. Familiarity with the creative industry and standard methodologies is a bonus. Technical Skills Understanding of Adobe's Digital Experience solutions such as AEM and Workfront. Demonstrated knowledge of Creative Cloud Tools (e.g., Photoshop, Illustrator, InDesign, Video, 3D). API knowledge is essential. In-depth experience with low-code development platforms (e.g., Microsoft More ❯

Reporting to: Senior E-Commerce Manager EMEIA Location: Woking, LondonThe ASSA ABLOY Opening Solutions EMEA division leads the development within door openings and products for access solutions in homes, businesses and institutions. Our offering includes doors, door and window hardware, locks, access control and service. The division has an annual turnover of over €2 billion and over … displayed consistently well across online touchpoints through online merchandising Act as a "super user" in e-commerce activation tools - Adobe Commerce, HCL Commerce and Adobe Experience Manager Gather and define requirements for new product and campaign launches and take responsibility for reporting on outcomes and overall performance Experience: Experience working with commerce … channels with an understanding of how to manage and track sales performance Working experience with website and e-commerce CMS tools, Adobe Commerce (Magento) preferable Experience managing product data and content on websites Strong understanding of direct to consumer marketing and content and experience working with cross functional teams to activate e-commerce sales channels More ❯

people, processes, and technology to improve orchestration across the entire marketing lifecycle. As an Adobe Platinum Solution Partner, LeapPoint's expertise spans the entire Adobe Experience Cloud ecosystem. The company's certified consultants have delivered more than 600,000 hours of Adobe-related implementations and integrations and actively support hundreds of enterprise-level … clients. LeapPoint is part of Omnicom's precision marketing division, Omnicom Precision Marketing Group (OPMG) , a global network of agencies and consultancies spanning CRM, customer experience design, marketing technology, and business consulting. We are seeking an experienced and results-driven Senior Sales Consultant to help lead the expansion of Adobe Marketing Solutions across our customers. Working with … developing, and winning new business opportunities through channel partnerships. Self-motivated, entrepreneurial spirit, and hungry for success. Executive presence with excellent written, presentation, and verbal communication skills. Knowledge of AEM Assets and Sites, Adobe Workfront, and Adobe Experience Platform. Travel: This position may require approximately 30-40% travel, mostly within the UK. HERE'S A More ❯

This position sits in our UKI Experience & Engineering business unit. Our team combines technology and experience design to create emotive yet conversion-focused ideas, products and campaigns at scale and speed. Our specialty are digital experiences and communication that change perceptions and shape new behaviours to make a difference in the market. ROLE OVERVIEW The Adobe Sales Director UKI will be responsible for driving business growth by leading sales efforts focused on Adobe's suite of solutions, including Adobe Experience Cloud, Adobe Commerce, and Creative Cloud. This role demands a strategic, results-driven leader with a deep understanding of the Adobe ecosystem and the ability … 's product roadmap and market trends, ensuring DEPT maintains a competitive edge. Provide insights to the leadership team regarding market opportunities and challenges. WHAT WE ARE LOOKING FOR Experience: Excellent track record in pipeline generation and pipeline conversion, including strong network of relationships; Proven ability in selling Adobe Experience Cloud products at a different digital More ❯

open and friendly. We value outcomes over hours and agility over rigid processes. Join the team - . We're looking for a freelance Fullstack Engineer, with circa 5 years experience,to help build highly resilient websites for a new client in the telecommunications industry. You will be part of a self - organising and cross functional Agile team, c reating … improvement of its tools and processes Be responsible for ensuring our website , app and c hatbot channels are highly performant, resilient, secure and monitored in production. Key Requirements: Strong experience withNext.js, React.js,Node.js (Fastify), Redux, GraphQL Proficient in Typescript and modern JavaScript (ES6+) Experience withAEM (Adobe Experience Manager) as headless CMS Familiar with headless … commerce frameworks Familiar withChakra-UI/Custom-UI, Storybook, Chromatic, Experience withAirTable Experience withAPI integration (RESTful, GraphQL, Magento 2 preferred) DevOps/cloud experience (AWS, Azure, CI/CD, automation) Experience with data structure libraries such as Immutable.js Agile/SCRUM and cross-functional team experience Solid understanding of fullstack development principles Comfortable working with More ❯

WebApplicationSupportAnalyst £35,000DOE Remote Werelookingforaproactiveanddetail-orientedWebApplicationSupportAnalysttojoinourclientsDigitalteam.Inthisrole,youllprovidetechnicalandfunctionalsupportfortheirwebplatforms,primarilyfocusedonAdobeExperienceManager(AEM)andGoogleSearchConsole.Youllplayakeypartinensuringthestability,performance,andcontinuousimprovementofcustomersdigitalexperience. KeyResponsibilities Provide1stand2ndlinesupportforwebapplications,withafocusonAEM-basedwebsites. Troubleshootissuesrelatedtocontentpublishing,pagerendering,siteperformance,andmetadatainAEM. MonitorandreportonsiteperformanceandsearchindexingviaGoogleSearchConsole. Collaboratewithdevelopers,contenteditors,QA,andDevOpsteamstoresolvetechnicalissues. Manageandtrackincidentsandservicerequests,ensuringtimelyresolutionandstakeholdercommunication. Supportcontentdeploymentcyclesandwebsitereleases. Documentcommonissuesandsolutions,contributingtoagrowingknowledgebase. HelpensureSEObestpracticesareimplementedandmaintainedacrossthesite. WhatWereLookingFor Provenexperienceinawebapplicationsupportordigitaloperationsrole. Hands-onexperiencewithAdobeExperienceManager(AEM)orsimilarCMSplatforms. WorkingknowledgeofGoogleSearchConsoleandbasicSEOtroubleshooting. UnderstandingofHTML,CSS,andwebtechnologies. Strongproblem-solvingandanalyticalskills. Excellentcommunicationskillsabletotranslatetechnicaldetailsintosimpletermsfornon-technicalusers. Experiencewithticketingsystems(e.g.Jira,ServiceNow)andITILframeworksisaplus. NicetoHave Familiaritywithwebanalyticstools(e.g.GoogleAnalytics,AdobeAnalytics). Understandingofaccessibilityandwebperformancestandards. ExperienceworkinginAgileenvironments. WhyJoin? Bepartofadynamicdigitalteamdrivingrealimpact. Workwithleadingtechnologiesinthewebandcontentmanagementspace. Accessprofessionaldevelopmentandlearningopportunities. More ❯

for an experienced and highly motivated Strategic Sales Account Executive to join our Digital Experience team. This role focuses on selling Adobe Experience Manager (AEM) and Adobe Workfront, helping medium and large enterprises transform how they manage content, assets, and work. You'll be at the forefront of driving pipeline and revenue growth … and manage trusted relationships at C-level and VP-level within key enterprise accounts Deliver compelling, insight-led value propositions that connect Adobe Experience Manager (AEM) and Workfront to measurable business outcomes Own and lead the full sales cycle from discovery to negotiation and contract closure - across both software and services Accurately forecast pipeline and revenue … in negotiating complex contracts and closing high-value deals with C-level executives Product and Industry Knowledge Knowledge of Adobe Experience Cloud, with a focus on AEM and Workfront Understanding of content management, digital asset management, and work management transformation Experience in the Professional Services & Technology industry is a strong plus Customer-Centric Approach Ability to More ❯

role will partner with Adobe's Account Executives to help grow the existing business through identifying cross-sell and upsell opportunities. This role requires solution selling capabilities, experience selling value to customers, strong business and selling instincts, and direct, in-person consultation with customers. The Firefly Services Product Specialist is responsible for guiding and navigating through an … contractual agreement to close sale. Qualifications Minimum 5+ years consistent track record of enterprise-level, technical solution direct sales expertise within a more sophisticated sales model is required. Shown experience consulting and selling digital transformation and enterprise solutions to "C-Suite" executives and overachieving on quotas is required. Excellent communication and collaboration skills, with the ability to work effectively … non-technical collaborators. Experience working with Adobe Creative Cloud products (i.e., Photoshop, Illustrator, InDesign, and After Effects) or Adobe Experience Cloud products (i.e., AEM, AEP) is a plus. Knowledge of generative AI technologies, including deep learning, neural networks, and generative models is a plus. Strong knowledge of creative workflows and the design process, with More ❯